Frequenin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10340

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Frequenin (NP_055101). Peptide sequence EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Frequenin Antibody - BSA Free

Western Blot: Frequenin Antibody [NBP3-10340]

Western Blot: Frequenin Antibody [NBP3-10340]

Western Blot: Frequenin Antibody [NBP3-10340] - Western blot analysis using NBP3-10340 on Human Thymus as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for Frequenin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Frequenin

Frequenin is a Ca2+ binding protein implicated in the regulation of neurotransmitter release at the neuromuscular junction. Frequenin amino acid sequences from different species appear closely related. In mouse a single 4.2 kbp mRNA is produced yielding a protein of 22 kDa when assayed by SDS-PAGE under reducing conditions. Frequenin may colocalize with the dendritic marker MAP-2 and is widely distributed in the brain, spinal cord and dorsal root ganglia. In Drosophila frequenin is related to recoverin and visinin and functions like Ca2+-sensitive guanylyl cyclase activator.

Alternate Names

DKFZp761L1223, FREQFLUP, frequenin (Drosophila) homolog, Frequenin homolog, frequenin homolog (Drosophila), Frequenin-like protein, Frequenin-like ubiquitous protein, NCS-1, neuronal calcium sensor 1

Gene Symbol

NCS1

Additional Frequenin Products

Product Documents for Frequenin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Frequenin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Frequenin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Frequenin Antibody - BSA Free and earn rewards!

Have you used Frequenin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...