Fucosyltransferase 3/FUT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54732

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Fucosyltransferase 3/FUT3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Fucosyltransferase 3/FUT3 Antibody [NBP2-54732]

Immunohistochemistry-Paraffin: Fucosyltransferase 3/FUT3 Antibody [NBP2-54732]

Immunohistochemistry-Paraffin: Blood Group Lewis b Antibody [NBP2-54732] - Staining of human small intestine shows strong cytoplasmic and nuclear positivity in glandular cells.

Applications for Fucosyltransferase 3/FUT3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fucosyltransferase 3/FUT3

Because N-, O-glycans and glycolipids are frequently fucosylated at terminal sites, fucose is often found to be essential for sugar epitope and lectin ligand generation. Well-known fucose containing structures include Lewis structures and ABO blood group antigens. Lewis structures are key elements involved in leukocyte homing and extravasation process and thus are essential for lymphocyte maturation and natural defense functions. Fucose containing glycans also play essential roles in cell signaling and development. So far, more than 10 fucosyltransferases have been cloned from the human genome. FUT1 and FUT2 are alpha 1-2 fucosyltransferases and are responsible for ABO blood group antigen synthesis. FUT3, FUT4, FUT5, FUT6, FUT7 and FUT9 are responsible for Lewis structure generation through their alpha 1-3 or alpha 1-4 fucosyltransferases activities. FUT3, also known as Lewis blood group fucosyltransferase, is unique by having both strong alpha 1-3 and alpha 1-4 fucosyltransferase activities. FUT3 has high homology with FUT5 and FUT6 due to gene duplication. FUT7 is exclusively responsible for biosynthesis of sialyl Lewis X epitope in leukocytes and high endothelial venule cells. FUT8 is an alpha 1-6 fucosyltransferase that adds a fucose to the chitobiose core of N-glycans. Predicted as type II transmembrane proteins and Golgi enzymes, some of the fucosyltransferases can also be found in plasma. R&D Systems rhFUTs correspond to the luminal domains.

Alternate Names

CD174, FT3B, FucT-III, FUT3, Les, Lewis FT

Gene Symbol

FUT3

Additional Fucosyltransferase 3/FUT3 Products

Product Documents for Fucosyltransferase 3/FUT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fucosyltransferase 3/FUT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Fucosyltransferase 3/FUT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fucosyltransferase 3/FUT3 Antibody - BSA Free and earn rewards!

Have you used Fucosyltransferase 3/FUT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...