Because N-, O-glycans and glycolipids are frequently fucosylated at terminal sites, fucose is often found to be essential for sugar epitope and lectin ligand generation. Well-known fucose containing structures include Lewis structures and ABO blood group antigens. Lewis structures are key elements involved in leukocyte homing and extravasation process and thus are essential for lymphocyte maturation and natural defense functions. Fucose containing glycans also play essential roles in cell signaling and development. So far, more than 10 fucosyltransferases have been cloned from the human genome. FUT1 and FUT2 are alpha 1-2 fucosyltransferases and are responsible for ABO blood group antigen synthesis. FUT3, FUT4, FUT5, FUT6, FUT7 and FUT9 are responsible for Lewis structure generation through their alpha 1-3 or alpha 1-4 fucosyltransferases activities. FUT3, also known as Lewis blood group fucosyltransferase, is unique by having both strong alpha 1-3 and alpha 1-4 fucosyltransferase activities. FUT3 has high homology with FUT5 and FUT6 due to gene duplication. FUT7 is exclusively responsible for biosynthesis of sialyl Lewis X epitope in leukocytes and high endothelial venule cells. FUT8 is an alpha 1-6 fucosyltransferase that adds a fucose to the chitobiose core of N-glycans. Predicted as type II transmembrane proteins and Golgi enzymes, some of the fucosyltransferases can also be found in plasma. R&D Systems rhFUTs correspond to the luminal domains.
Fucosyltransferase 3/FUT3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-54732
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Fucosyltransferase 3/FUT3 Antibody - BSA Free
Immunohistochemistry-Paraffin: Fucosyltransferase 3/FUT3 Antibody [NBP2-54732]
Immunohistochemistry-Paraffin: Blood Group Lewis b Antibody [NBP2-54732] - Staining of human small intestine shows strong cytoplasmic and nuclear positivity in glandular cells.Applications for Fucosyltransferase 3/FUT3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Fucosyltransferase 3/FUT3
Alternate Names
CD174, FT3B, FucT-III, FUT3, Les, Lewis FT
Gene Symbol
FUT3
Additional Fucosyltransferase 3/FUT3 Products
Product Documents for Fucosyltransferase 3/FUT3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Fucosyltransferase 3/FUT3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Fucosyltransferase 3/FUT3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Fucosyltransferase 3/FUT3 Antibody - BSA Free and earn rewards!
Have you used Fucosyltransferase 3/FUT3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...