FXYD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81256

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19893046)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FXYD3 Antibody - BSA Free

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256]

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256]

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256] - Staining in human prostate and pancreas tissues using anti-FXYD3 antibody. Corresponding FXYD3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256]

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256]

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256]

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256]

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256] - Staining of human prostate shows high expression.

Applications for FXYD3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FXYD3

FXYD3, also known as FXYD domain-containing ion transport regulator 3, consists of 3 isoforms, a 87 amino acid isoform that is 9 kDa, a 113 amino acid isoform that is 12 kDa, and a 144 amino acid that is 15 kDa; is membrane located, functions as an inducer of a hyperpolarization-activated chloride current when expressed in Xenopus oocytes, and may be a modulator capable of activating endogenous oocyte channels. Current research is being performed on several diseases and disorders including adenocarcinoma, pancreatic, ductal adenocarcinoma, intrahepatic cholangiocarcinoma, colorectal cancer, cholangiocarcinoma prostate carcinoma, melanoma, pancreatic cancer, pancreatitis, prostate cancer, breast cancer, and prostatitis. The FXYD3 protein has also shown an interaction with SERBP1, FBXL12, NR4A1, MAPK6 and NUDT3, in the regulation of catalytic activity, ion transport, and chloride transport pathways.

Alternate Names

Chloride conductance inducer protein Mat-8, FXYD domain containing ion transport regulator 3, FXYD domain-containing ion transport regulator 3, Mammary tumor 8 kDa protein, MAT8MAT-8, Phospholemman-like, phospholemman-like protein, PLMLMGC111076

Gene Symbol

FXYD3

Additional FXYD3 Products

Product Documents for FXYD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FXYD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FXYD3 Antibody - BSA Free

Customer Reviews for FXYD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FXYD3 Antibody - BSA Free and earn rewards!

Have you used FXYD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...