G protein alpha-13 Antibody (8M1U0)

Novus Biologicals | Catalog # NBP3-33226

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8M1U0
View all G protein alpha-13 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 278-377 of human G protein alpha-13 (Q14344).

Sequence:
NRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for G protein alpha-13 Antibody (8M1U0)

G protein alpha-13 Antibody (8M1U0)

Western Blot: G protein alpha-13 Antibody (8M1U0) [NBP3-33226] -

Western Blot: G protein alpha-13 Antibody (8M1U0) [NBP3-33226] - Western blot analysis of various lysates using G protein alpha-13 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for G protein alpha-13 Antibody (8M1U0)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: G protein alpha-13

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems

Alternate Names

G alpha-13, G13, G-protein subunit alpha-13, guanine nucleotide binding protein (G protein), alpha 13, guanine nucleotide-binding protein subunit alpha-13, MGC46138

Gene Symbol

GNA13

Additional G protein alpha-13 Products

Product Documents for G protein alpha-13 Antibody (8M1U0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for G protein alpha-13 Antibody (8M1U0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G protein alpha-13 Antibody (8M1U0)

There are currently no reviews for this product. Be the first to review G protein alpha-13 Antibody (8M1U0) and earn rewards!

Have you used G protein alpha-13 Antibody (8M1U0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies