GAB1 Antibody (5C5Q1)

Novus Biologicals | Catalog # NBP3-33428

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5C5Q1
View all GAB1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 594-694 of human GAB1 (NP_002030.2).

Sequence:
PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GAB1 Antibody (5C5Q1)

GAB1 Antibody (5C5Q1)

Western Blot: GAB1 Antibody (5C5Q1) [NBP3-33428] -

Western Blot: GAB1 Antibody (5C5Q1) [NBP3-33428] - Western blot analysis of lysates from Mouse lung, using GAB1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for GAB1 Antibody (5C5Q1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GAB1

Growth factor triggering of protein tyrosine kinase receptors induces signals that cascade to the nucleus, activating mitogenic as well as other responses. Critical components of this process include adapter protein such as Shc, IRS-1 and Gab 1 (GRB-associated binder-1) that lack detectable catalytic activity. These are immediate substrates of receptor tyrosine kinase activity and serve to link activated receptors to downstream signaling components. Whereas Shc has been implicated in signaling by diverse receptor families, IRS-1 serves primarily as the major insulin receptor substrate. Shc and Gab 1 also participate in insulin signaling by linking the insulin receptor to Ras by forming complexes with GRB2 (another adapter protein) and Sos independently of IRS-1. Gab 1 is also thought to be involved in the EGF receptor signaling pathway.

Long Name

GRB2-associated Binding Protein 1

Alternate Names

GRB2-associated binder 1, GRB2-associated binding protein 1, GRB2-associated-binding protein 1, Growth factor receptor bound protein 2-associated protein 1

Gene Symbol

GAB1

Additional GAB1 Products

Product Documents for GAB1 Antibody (5C5Q1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAB1 Antibody (5C5Q1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAB1 Antibody (5C5Q1)

There are currently no reviews for this product. Be the first to review GAB1 Antibody (5C5Q1) and earn rewards!

Have you used GAB1 Antibody (5C5Q1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies