Galectin-9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33484

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Galectin-9 Antibody - BSA Free

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Analysis in human rectum and skeletal muscle tissues using NBP2-33484 antibody. Corresponding Galectin-9 RNA-seq data are presented for the same tissues.
Western Blot: Galectin-9 Antibody [NBP2-33484]

Western Blot: Galectin-9 Antibody [NBP2-33484]

Western Blot: Galectin-9 Antibody [NBP2-33484] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484]

Immunohistochemistry-Paraffin: Galectin-9 Antibody [NBP2-33484] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Applications for Galectin-9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Galectin-9

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin 9 is an S-type lectin and an eosinophil chemoattractant (ECA) produced by antigen-activated T cells. Galectin 9 is involved in apoptosis, is thought to be a prognostic factor for breast cancer and is also overexpressed in Hodgkin's disease tissue. The protein has N- and C- terminal carbohydrate-binding domains connected by a link peptide. Multiple alternatively spliced transcript variants have been found for this gene.

Alternate Names

Ecalectin, GAL9, Galectin9, LGALS9

Gene Symbol

LGALS9

UniProt

Additional Galectin-9 Products

Product Documents for Galectin-9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Galectin-9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Galectin-9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Galectin-9 Antibody - BSA Free and earn rewards!

Have you used Galectin-9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...