CRF21 (Cytochrome c-releasing factor 21; also C7orf24 or LOC79017) is a 21 kDa AIG2-like family member. It is a cytosolic protein that induces the release of Cytochrome c from mitochondria, possibly initiating apoptosis. Human CRF21 is 188 amino acids (aa) in length and is a complex of beta-sheets and alpha-helices that create two terminal domains. It has been proposed that CRF21 forms homodimers. There are at least two possible splice variants of human CRF21, one showing a 70 aa substitution, while the second variant shows an 18 aa substitution for aa 97-188. Full-length human CRF21 is 82% aa identical to mouse CRF21.
gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86727
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDE
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%). Reactivity reported in scientific literature (PMID: 22205682)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
Immunohistochemistry-Paraffin: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NBP1-86727]
Immunohistochemistry-Paraffin: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NBP1-86727] - Staining of human corpus, uterine shows moderate cytoplasmic positivity in glandular cells.Western Blot: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free [NBP1-86727]
Analysis in human cell line SK-BR-3.Applications for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: gamma-Glutamylcyclotransferase/CRF21
Long Name
Cytochrome c Releasing Factor 21
Alternate Names
C7orf24, CRF21, gammaGlutamylcyclotransferase, GCTG, GGC, GGCT, LOC79017
Entrez Gene IDs
79017 (Human)
Gene Symbol
GGCT
UniProt
Additional gamma-Glutamylcyclotransferase/CRF21 Products
Product Documents for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
Customer Reviews for gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free
There are currently no reviews for this product. Be the first to review gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free and earn rewards!
Have you used gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...