GAMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54399

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAMT Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GAMT(guanidinoacetate N-methyltransferase) The peptide sequence was selected from the middle region of GAMT. Peptide sequence PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GAMT Antibody - BSA Free

Western Blot: GAMT Antibody [NBP1-54399]

Western Blot: GAMT Antibody [NBP1-54399]

Western Blot: GAMT Antibody [NBP1-54399] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: GAMT Antibody [NBP1-54399]

Immunohistochemistry: GAMT Antibody [NBP1-54399]

Immunohistochemistry: GAMT Antibody [NBP1-54399] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Western Blot: GAMT Antibody [NBP1-54399]

Western Blot: GAMT Antibody [NBP1-54399]

Western Blot: GAMT Antibody [NBP1-54399] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Applications for GAMT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAMT

GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumula

Alternate Names

EC 2.1.1.2, guanidinoacetate N-methyltransferase, PIG2, TP53I2

Gene Symbol

GAMT

UniProt

A8K0A0 (Human)

Additional GAMT Products

Product Documents for GAMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAMT Antibody - BSA Free and earn rewards!

Have you used GAMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies