GAMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14036

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAMT Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GAMT Antibody - BSA Free

Western Blot: GAMT Antibody [NBP2-14036]

Western Blot: GAMT Antibody [NBP2-14036]

Western Blot: GAMT Antibody [NBP2-14036] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human rectum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human liver shows weak to moderate cytoplasmic postivity in hepatocytes na moderate staining of bile canaliculi.
Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human placenta shows strong cytoplasmic postivity in trophoblastic cells.
Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036]

Immunohistochemistry-Paraffin: GAMT Antibody [NBP2-14036] - Staining of human pancreas shows moderate to strong cytoplasmic postivity in exocrine glandular cells.
GAMT Antibody - BSA Free

Western Blot: GAMT Antibody - BSA Free [NBP2-14036] -

Expression levels of creatine biosynthetic enzymes in a panel of C57BL/6J mouse tissues. (A,D) mRNA and protein levels respectively, for AGAT. (B,E) mRNA and protein levels, respectively for GAMT. (C) mRNA levels for Slc6A8 (Creatine transporter). (F) Representative images from protein electrophoresis showing total protein panel used for normalization purposes, in addition to protein signal detected for AGAT (48 kDa) and GAMT (28 kDa). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36017222), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GAMT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAMT

GAMT is encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene.

Alternate Names

EC 2.1.1.2, guanidinoacetate N-methyltransferase, PIG2, TP53I2

Gene Symbol

GAMT

Additional GAMT Products

Product Documents for GAMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAMT Antibody - BSA Free and earn rewards!

Have you used GAMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies