GAS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-04395

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAS2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1). MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GAS2 Antibody - BSA Free

Western Blot: GAS2 AntibodyBSA Free [NBP3-04395]

Western Blot: GAS2 AntibodyBSA Free [NBP3-04395]

Western Blot: GAS2 Antibody [NBP3-04395] - Analysis of extracts of various cell lines, using GAS2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunohistochemistry-Paraffin: GAS2 Antibody - BSA Free [NBP3-04395]

Immunohistochemistry-Paraffin: GAS2 Antibody - BSA Free [NBP3-04395]

Immunohistochemistry-Paraffin: GAS2 Antibody [NBP3-04395] - Paraffin-embedded human liver cancer using GAS2 antibody at dilution of 1:200 (40x lens).

Applications for GAS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GAS2

GAS2 is encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Alternate Names

GAS-2, growth arrest-specific 2, growth arrest-specific protein 2, MGC32610

Gene Symbol

GAS2

Additional GAS2 Products

Product Documents for GAS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAS2 Antibody - BSA Free and earn rewards!

Have you used GAS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies