Gasdermin-C Antibody (1G8H5)

Novus Biologicals | Catalog # NBP3-33302

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1G8H5
View all Gasdermin-C Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Gasdermin-C (NP_113603.1).

Sequence:
MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Gasdermin-C Antibody (1G8H5)

Gasdermin-C Antibody (1G8H5)

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] -

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] - Western blot analysis of lysates from Rat stomach, using Gasdermin-C Rabbit mAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Gasdermin-C Antibody (1G8H5)

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] -

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] - Western blot analysis of various lysates using Gasdermin-C Rabbit mAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Gasdermin-C Antibody (1G8H5)

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] -

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] - Western blot analysis of lysates from HeLa cells, using Gasdermin-C Rabbit mAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Gasdermin-C Antibody (1G8H5)

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] -

Western Blot: Gasdermin-C Antibody (1G8H5) [NBP3-33302] - Western blot analysis of lysates from type (WT) and 293F cells transfected with GSDMC using GSDMC Rabbit mAb at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Gasdermin-C Antibody (1G8H5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Gasdermin-C

Alternate Names

gasdermin C, gasdermin-C, Melanoma-derived leucine zipper-containing extranuclear factor, MLZEmelanoma-derived leucine zipper, extra-nuclear factor

Gene Symbol

GSDMC

Additional Gasdermin-C Products

Product Documents for Gasdermin-C Antibody (1G8H5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Gasdermin-C Antibody (1G8H5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Gasdermin-C Antibody (1G8H5)

There are currently no reviews for this product. Be the first to review Gasdermin-C Antibody (1G8H5) and earn rewards!

Have you used Gasdermin-C Antibody (1G8H5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies