Gasdermin D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33422

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Rat, Porcine

Applications

Validated:

Western Blot, Simple Western

Cited:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chemotaxis, IF/IHC, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Gasdermin D Antibody - BSA Free

Western Blot Detection of GSDMDC1 in Multiple Cell Lines

Western Blot Detection of GSDMDC1 in Multiple Cell Lines

Analysis in human cell lines U2OS and HEK293 using anti-GSDMD antibody. Corresponding GSDMD RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Western Blot Analysis of GSDMDC1 in Treated THP1 Cells

Western Blot Analysis of GSDMDC1 in Treated THP1 Cells

GSDMD from cell lysates of THP1 treated by staphylococcus aureus alpha toxin was detected by immunoblot using GSDMD antibody (NBP2-33422) at 2 ug/mL. WB image submitted by a verified customer review.
Western Blotting of GSDMDC1 in SFV4-Infected HOS and A549 Cells

Western Blotting of GSDMDC1 in SFV4-Infected HOS and A549 Cells

GSDMDC1-Antibody-Western-Blot-NBP2-33422-img0025.jpg
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - miR-513c-5p negatively regulates caspase-1 expression in HUVECs. (A) The expression of miR-513c-5p after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was evaluated by qRT-PCR. (B) The expression level of caspase-1 mRNA after NC, miR-513c-5p mimics, INC & miR-513c-5p inhibitor transfection was detected by qRT-PCR. (C,D) Expression of caspase-1 in HUVECs were detected after transfection NC, miR-513c-5p mimics, INC, miR-513c-5p inhibitor by immunofluorescence staining (magnification, ×40). Scale bar = 200 μm. (E,F) Protein expression levels of caspase-1 & GSDMD were examined by Western blot. (G) The expression of IL-1 beta & IL-18 was detected by ELISA. *p < 0.05, **p < 0.01, & ***p < 0.001, ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosome formation in the cortex & hippocampus of aged mice: Aging induces laddering of ASC in cortex (a) & hippocampus (b) of mice, indicating formation of the pyroptosome, an oligomerization of ASC that leads to pyroptosis. Representative immunoblot & quantification of gasdermin-D in the cortex (c) & hippocampus (d) of aged mice when compared to young. Gasdermin-D is significantly elevated in the cortex & hippocampus of aged mice. Data presented as mean+/-SEM. N = 5 per group. * p < 0.05 Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30473634), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Expressions of caspase-1, GSDMD, IL-1 beta, & IL-18 are up-regulated in DVT patients. (A) mRNA level of caspase-1 in the PBMCs from 30 DVT patients & 30 controls was determined by qRT-PCR. (B) Caspase-1 & GSDMD protein levels were measured in PBMCs of DVT subjects & controls by Western blot. (C,D) Protein levels of IL-1 beta & IL-18 in the serum from 12 DVT patients & 12 controls were determined by ELISA. ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Overexpression of miR-513c-5p suppresses pyroptosis of VECs & DVT formation by inhibiting caspase-1. (A) Expression of miR-513c-5p in vascular tissue was detected by qRT-PCR in DVT mice treated with NC, miR-513c-5p mimics, respectively. (B) Relative expression of miR-513c-5p was measured by qRT-PCR in PBMCs of DVT each treatment group. (C) Confocal microscopy images of miR-513c-5p expression in vascular tissues (miR-513c-5p, red; DAPI, blue) (magnification, ×200). Scale bars = 100 μm. (D) H&E staining of serial cross sections of inferior vena cava (IVC) from DVT mice treated with NC, miR-513c-5p mimics at 48 h (magnification, ×40), respectively. Scale bars = 500 μm. (E) Representative images of thrombi in each treatment group were detected by vascular ultrasound at 48 h post-operation. (F) Thrombus length & weight at 48 h post-operation in DVT mice (n = 15) treated with NC, miR-513c-5p mimics. (G) Caspase-1 mRNA level was determined by qRT-PCR in vascular tissue of each treatment group. (H) Caspase-1 & GSDMD protein levels were determined by Western blot in vascular tissue of DVT each treatment group. (I) IL-1 beta & IL-18 protein levels in vascular tissue were determined by ELISA in DVT each treatment group. **p < 0.01, ***p < 0.001, & ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Caspase-1 inhibitor (vx-765) inhibits the formation of DVT in vivo. (A,B) H&E staining of serial cross sections of IVC from Ctrl, Sham, DVT, DVT+vehicle, DVT+vx-765, DVT+vehicle+miR-513c-5p inhibitor, DVT+vx-765+miR-513c-5p inhibitor at 48 h (magnification, ×40). Scale bars = 500 μm. (C,D) Thrombus length & weight at 48 h post-operation in the different treatment groups after the administration of caspase-1 inhibitor (vx-765) (n = 15 in each group). (E) Representative images of thrombi in each treatment group were detected by vascular ultrasound at 48 h post-operation. (F) Caspase-1 & GSDMD protein levels were determined by Western blot in vascular tissue of DVT animal group & vx-765-treated groups. (G) Expression of IL-1 beta & IL-18 in vascular tissue were detected by ELISA with vx-765 treated each group. **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - mIL-18 release from unprimed monocytes is dependent on GSDMD. (A, B) Unprimed THP-1 cells pre-incubated with punicalagin (50 µM, 15 min) prior to treatment with nigericin (10 µM, 45 min). (C, D) Unprimed WT & GSDMD KO THP-1s were treated with nigericin (10 µM, 45 min). (A, C) Secreted IL-18 was measured by ELISA & cell death was measured by LDH assay & shown as percentage relative to total cell death, n=3 independent biological replicates, mean ± S.D., *P < 0.05; ***P <0.001; ****P <0.0001; ns (not significant) using one-way ANOVA comparing each sample to nigericin only treated sample (A) or two-way ANOVA comparing UT to nigericin treated WT THP-1s as well as nigericin treated WT THP-1s to nigericin treated GSDMD KO THP-1s. (C). (B, D) Western blot analysis of THP-1 cells for mIL-18 (18 kDa), pro-IL-18 (24 kDa), mCaspase-1 (20 kDa), pro-Caspase-1 (45 kDa), GSDMD full length (FL, 53 kDa), GSDMD N-terminus (NT, 31 kDa), as well as loading control beta -actin (42 kDa). Blots are representative of at least 3 independent experiments. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33101286), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Priming is not required for NLRP3 inflammasome activation in human monocytes in vitro. (A, B) Undifferentiated THP-1 cells (n=6 independent biological replicates) & (C, D) primary CD14+ monocytes (n=6 independent biological replicates (each point represents a different blood donor)) were left untreated or primed with LPS (1 µg/ml, 4 h) prior to treatment with nigericin (10 µM, 45 min) to activate the NLRP3 inflammasome. (A, C) IL-1 beta & IL-18 were measured by ELISA & cell death was measured by LDH assay & shown as percentage relative to total cell death, mean ± S.D., *P < 0.05; **P < 0.01; ***P < 0.001; ns (non significant) using one-way ANOVA comparing all groups. (B, D) Western blot analysis for mIL-18 (18 kDa), pro-IL-18 (24 kDa), mIL-1 beta (17 kDa), pro-IL-1 beta (34 kDa), mCaspase-1 (20 kDa), pro-Caspase-1 (45 kDa), GSDMD full length (FL, 53 kDa), GSDMD N-terminus (NT, 31 kDa), UBE2L3 (17.9 kDa), NLRP3 (113 kDa), as well as loading control beta -actin (42 kDa). Blots are representative of at least 3 independent biological experiments & in case of monocytes 3 different blood donors. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33101286), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Glyburide attenuates NLRP3 inflammasome-mediated pyroptosis in HCECs infected with HKCA. HCECs were pretreated with potassium (K+) channel inhibitor (glyburide) for 2 h, & then were incubated with HKCA (MOI = 20) for 24 h. (A,B) Western blot showing the protein levels of NLRP3 in HCECs treated with various concentrations of glyburide (50, 100 & 200 μM) (n = 3). (C,D) Glyburide treatment (200 μM) suppressed the levels of pyroptosis-related proteins (ASC, cleaved CASP1, N-GSDMD, cleaved IL-1 beta & cleaved IL-18) in HCECs challenged with HKCA at 20:1 for 24 h (n = 3). (E) Immunofluorescence analysis of NLRP3, CASP1 & ASC in HCECs pretreated with or without glyburide (200 μM) for 24 h (n = 3). Scale bar = 20 μm; magnification 400×. (F) LDH release of HCECs treated with glyburide (200 μM) (n = 6). CASP1: caspase-1; Clv-CASP1: cleaved CASP1; Clv-IL-1 beta : cleaved IL-1 beta ; Clv-IL-18: cleaved IL-18; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. N.S. P>0.05; *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis is occurred in mouse corneas of C. albicans keratitis. (A) RT-qPCR analysis of the mRNA levels of pyroptosis-associated genes (ASC/CASP1/GSDMD/IL-1 beta /IL-18) in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (B,C) Western blot detecting pyroptosis-related proteins of ASC, cleaved CASP1, cleaved IL-1 beta, cleaved IL-18, F-GSDMD & N-GSDMD in mouse corneas at 0 (control), 1, 3, & 7 dpi (n = 3). (D) Double-immunofluorescence staining of CASP1 & TUNEL in C. albicans infected-corneas compared with mock-infected controls (n = 3; Scale bar = 20 μm; magnification 400×). CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - NLRP3 knockdown attenuates the pyroptosis in mouse C. albicans keratitis. (A–C) RT-qPCR analysis & western blot showing the mRNA & protein levels of pyroptosis-related molecules in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (D) Immunofluorescence staining of ASC, CASP1 & GSDMD in C. albicans-infected corneas pretreated with Ad-GFP-shRNA & Ad-NLRP3- shRNA compared with mock controls (n = 3). (E) Double-immunofluorescence staining of CASP1 & TUNEL in the mice cornea of Ad-NLRP3-shRNA group compared with the Ad-GFP-shRNA group (n = 3). Scale bar = 20 μm; magnification 400×. FK: fungal keratitis. CASP1: caspase-1; Clv-CASP1:cleaved CASP1; Clv-IL-1 beta :cleaved IL-1 beta ; Clv-IL-18:cleaved IL-18; F-GSDMD: p53 form of GSDMD; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Knockdown of miR-513c-5p promotes pyroptosis of VECs & DVT formation by increasing caspase-1. (A) The expression level of miR-513c-5p in vascular tissue was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (B) Expression of miR-513c-5p in PBMCs was detected by qRT-PCR in DVT mice treated with INC, miR-513c-5p inhibitor, respectively. (C) Confocal microscopy images of miR-513c-5p expression in vascular tissues (miR-513c-5p, red; DAPI, blue) (magnification, ×200). Scale bars = 100 μm. (D) H&E staining of serial cross sections of inferior vena cava (IVC) from DVT mice treated with INC, miR-513c-5p inhibitor at 48 h (magnification, ×40). Scale bars = 500 μm. (E) Representative images of thrombi in each treatment group were detected by vascular ultrasound at 48 h post-operation. (F) Thrombus length & weight at 48 h post-operation in the different treatment groups (n = 15 in each group). (G) Caspase-1 mRNA level was determined by qRT-PCR in vascular tissue of each treatment group. (H) Caspase-1 & GSDMD protein levels were determined by Western blot in vascular tissue of DVT mice treated with INC, miR-513c-5p inhibitor. (I) IL-1 beta & IL-18 protein levels in vascular tissue were determined by ELISA in INC, miR-513c-5p inhibitor treated DVT mice models, respectively. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35445025), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Pyroptosis & IL-1 beta release is dependent on the B. pseudomallei T3SS-3.hMDMs were infected with B. pseudomallei (MOI 300) for 3h. (A & B) Cell death induction & intracellular bacterial burden were determined at 0 & 3h p.i. Shown are the median & interquartile range of at least three independent experiments with different donors performed in technical duplicates. (C) IL-1 beta secretion was determined 3h p.i. Data are presented as median & interquartile range of four independent experiments with different donors performed in duplicates. (D) Caspase-1 & gasdermin-D processing were investigated 3h p.i. Lysates were re-probed for beta -actin. For immunoblot analysis one representative experiment of at least three with different donors is shown. (E) Growth analysis of wt & delta bsaL was performed. Shown are mean values of three independent experiments performed in technical triplicates. (*p < 0.05, **p < 0.01). n.i. (not infected), wt (wild type), b.d. (below detection), hours (h), p.i. (post infection), GSDMD (gasdermin D). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33137811), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Priming is not required for NLRP3 inflammasome activation in human monocytes in vitro. (A, B) Undifferentiated THP-1 cells (n=6 independent biological replicates) & (C, D) primary CD14+ monocytes (n=6 independent biological replicates (each point represents a different blood donor)) were left untreated or primed with LPS (1 µg/ml, 4 h) prior to treatment with nigericin (10 µM, 45 min) to activate the NLRP3 inflammasome. (A, C) IL-1 beta & IL-18 were measured by ELISA & cell death was measured by LDH assay & shown as percentage relative to total cell death, mean ± S.D., *P < 0.05; **P < 0.01; ***P < 0.001; ns (non significant) using one-way ANOVA comparing all groups. (B, D) Western blot analysis for mIL-18 (18 kDa), pro-IL-18 (24 kDa), mIL-1 beta (17 kDa), pro-IL-1 beta (34 kDa), mCaspase-1 (20 kDa), pro-Caspase-1 (45 kDa), GSDMD full length (FL, 53 kDa), GSDMD N-terminus (NT, 31 kDa), UBE2L3 (17.9 kDa), NLRP3 (113 kDa), as well as loading control beta -actin (42 kDa). Blots are representative of at least 3 independent biological experiments & in case of monocytes 3 different blood donors. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33101286), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] -

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Heat-killed C. albicans (HKCA) activates NLRP3 inflammasome & induces pyroptosis in human corneal epithelial cells (HCECs). (A) The mRNA expression of NLRP3 in HCECs challenged with HKCA at an MOI of 1:500, 1:50, 1:5, 2:1, or 20:1 respectively for 4 hours was evaluated by RT-qPCR (n = 5). (B–D) The mRNA & protein expression of NLRP3 in HCECs exposed to HKCA (MOI = 20) for 0 (control), 2, 4, 8, 12, or 24 h (n = 3). (E) NLRP3 fluorescence intensity was evaluated using immunofluorescent staining for different times (12–36 h). (n = 3; Scale bar = 20 μm; magnification 400×). (F) Lactate dehydrogenase (LDH) of HCECs treated with HKCA (MOI = 20) for 24 h (n = 6). (G) The mRNA levels of ASC, CASP1, IL-1 beta, IL-18 & GSDMD in HCECs exposed to HKCA (MOI = 20) for different times (n = 3). (H,I) The protein expression of pyroptosis-related proteins (ASC, cleaved CASP1, N-GSDMD, cleaved IL-1 beta & cleaved IL-18) was examined by western blot (n = 3). CASP1: caspase-1; Clv-CASP1: cleaved CASP1; Clv-IL-1 beta : cleaved IL-1 beta ; Clv-IL-18: cleaved IL-18; N-GSDMD: cleaved p30 form of GSDMD. All values are presented as mean ± SEM. *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001 vs. control group. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35463001), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Gasdermin D Antibody - BSA Free

Application
Recommended Usage

Simple Western

1:25

Western Blot

0.04 - 0.4 ug/mL
Application Notes
See Simple Western Antibody Database for Simple Western validation: Tested in Human cells 1 mg/mL, separated by Size, antibody dilution of 1:25, apparent MW was 52 kDa

Reviewed Applications

Read 1 review rated 5 using NBP2-33422 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gasdermin D

Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Alternate Names

DF5L, DFNA5L, gasdermin domain containing 1, Gasdermin domain-containing protein 1, gasdermin-D, GSDMDC1

Gene Symbol

GSDMD

UniProt

Additional Gasdermin D Products

Product Documents for Gasdermin D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Gasdermin D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Gasdermin D Antibody - BSA Free

Customer Reviews for Gasdermin D Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Gasdermin D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • GSDMDC1 Antibody
    Name: Eric Wang
    Application: Western Blot
    Sample Tested: THP-1 cell lysate
    Species: Human
    Verified Customer | Posted 06/21/2021
    GSDMD from cell lysates of THP1 treated by staphylococcus aureus alpha toxin was detected by immunoblot using GSDMD antibodies (2 ug/ml; NBP2-33422).
    Gasdermin D Antibody - BSA Free NBP2-33422

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...