GAT-1/SLC6A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89802

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GAT-1/SLC6A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit GAT-1/SLC6A1 Antibody - BSA Free (NBP1-89802) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for GAT-1/SLC6A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802] - Immunohistochemical staining of human stomach shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802] - Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
GAT-1/SLC6A1 Antibody - BSA Free Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody - BSA Free [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody - BSA Free [NBP1-89802]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802]

Immunohistochemistry-Paraffin: GAT-1/SLC6A1 Antibody [NBP1-89802] - Immunohistochemical staining of human cerebellum shows moderate to strong membranous positivity in neuropil of molecular layer and in Purkinje cell layer.
GAT-1/SLC6A1 Antibody - BSA Free Western Blot: GAT-1/SLC6A1 Antibody - BSA Free [NBP1-89802]

Western Blot: GAT-1/SLC6A1 Antibody - BSA Free [NBP1-89802]

Analysis in human liver tissue.
GAT-1/SLC6A1 Antibody - BSA Free Western Blot: GAT-1/SLC6A1 Antibody - BSA Free [NBP1-89802]

Western Blot: GAT-1/SLC6A1 Antibody - BSA Free [NBP1-89802]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for GAT-1/SLC6A1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAT-1/SLC6A1

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a Cl negative channel associated with the GABAA receptor (GABAA-R) subtype. GABA plasma membrane transporters (GATs) influence synaptic neurotransmission by high-affinity uptake and release of GABA. To date, four distinct GABA transporters have been identified: GAT-1, GAT-2, GAT-3, and BGT-1. GAT-1, the most abundant of the transporters, is found predominantly in neurons, but also in some specialized glia (Minelli et al., 1995). GAT-1 is thought to play a key role in epileptogenesis (Zhao et al. 2003).

Long Name

GABA Transporter 1

Alternate Names

GABATHG, GABATR, GAT1, SLC6A1

Gene Symbol

SLC6A1

Additional GAT-1/SLC6A1 Products

Product Documents for GAT-1/SLC6A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GAT-1/SLC6A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GAT-1/SLC6A1 Antibody - BSA Free

Customer Reviews for GAT-1/SLC6A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAT-1/SLC6A1 Antibody - BSA Free and earn rewards!

Have you used GAT-1/SLC6A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies