GBE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85875

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GBE1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human testis.
Western Blot: GBE1 Antibody [NBP1-85875]

Western Blot: GBE1 Antibody [NBP1-85875]

Western Blot: GBE1 Antibody [NBP1-85875] - Analysis using Anti-GBE1 antibody NBP1-85875 (A) shows similar pattern to independent antibody NBP1-85877 (B).
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human colon, kidney, liver and testis using Anti-GBE1 antibody NBP1-85875 (A) shows similar protein distribution across tissues to independent antibody NBP1-85876 (B).
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human liver.
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human kidney.
Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875]

Immunohistochemistry-Paraffin: GBE1 Antibody [NBP1-85875] - Staining of human colon.
GBE1 Antibody - BSA Free Western Blot: GBE1 Antibody - BSA Free [NBP1-85875]

Western Blot: GBE1 Antibody - BSA Free [NBP1-85875]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for GBE1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-85875 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GBE1

GBE1 is encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease).

Alternate Names

1,4-alpha-glucan-branching enzyme, amylo-(1,4 to 1,6) transglucosidase, amylo-(1,4 to 1,6) transglycosylase, Brancher enzyme, EC 2.4.1.18, GBE, glucan (1,4-alpha), branching enzyme 1, glycogen branching enzyme, Glycogen-branching enzyme

Gene Symbol

GBE1

Additional GBE1 Products

Product Documents for GBE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GBE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GBE1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used GBE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card
Showing  1 - 1 of 1 review Showing All
Filter By:
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: hela whole cell lysate, primary hepatocyte lysate
    Species: Other
    Verified Customer | Posted 05/30/2015

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...