Gelsolin/GSN Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55565

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Gelsolin/GSN Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Gelsolin/GSN Antibody - BSA Free (NBP2-55565) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Gelsolin/GSN Antibody - BSA Free

Western Blot: Gelsolin/GSN Antibody [NBP2-55565]

Western Blot: Gelsolin/GSN Antibody [NBP2-55565]

Western Blot: Gelsolin/GSN Antibody [NBP2-55565] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565] - Staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in dendritic cells.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in Langerhans cells.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565]

Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP2-55565] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Applications for Gelsolin/GSN Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gelsolin/GSN

Gelsolin is a calcium regulated actin binding protein. Gelsolin is a regulator of actin filament assembly and disassembly and consists of six homologous subdomains (S1-S6). When C-terminal tail (S6) is bound to calcium ion, it straightens and exposes actin binding sites located on S2s helices, leading to Gelsolin actin-serving activity (1). Gelsolin is inhibited by phosphatidylinositol (4,5)-bisphosphate (PIP2), where PIP2 will bind to S1, S2, and S3 sites. Gelsolin is involved in podosome formation and has been linked to inhibition of apoptosis by preventing release of cytochrome C (2).

Alternate Names

ADF, AGEL, Brevin, GSN

Gene Symbol

GSN

Additional Gelsolin/GSN Products

Product Documents for Gelsolin/GSN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Gelsolin/GSN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Gelsolin/GSN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Gelsolin/GSN Antibody - BSA Free and earn rewards!

Have you used Gelsolin/GSN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies