GFAP Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-54748
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Predicted:
Rat (98%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This GFAP antibody was developed against a Recombinant Protein corresponding to amino acids: NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 32866544)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for GFAP Antibody - BSA Free
Immunohistochemistry-Paraffin: GFAP Antibody [NBP2-54748]
Immunohistochemistry-Paraffin: GFAP Antibody [NBP2-54748] - Staining of human pancreas shows low expression as expected.Immunohistochemistry-Paraffin: GFAP Antibody [NBP2-54748]
Immunohistochemistry-Paraffin: GFAP Antibody [NBP2-54748] - Staining of human cerebral cortex shows high expression.Applications for GFAP Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:5000 - 1:10000
Immunohistochemistry-Paraffin
1:5000 - 1:10000
Application Notes
HC-P, Retrieval method: HIER pH6
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GFAP
An increase in GFAP levels is often associated with neuroinflammation which results in the activation and proliferation of astroglia cell population (1,2). GFAP expression is also observed in brains of patients with neurodegenerative diseases including Alzheimer's and Parkinson's, epilepsy disorders, and brain injuries (1-4). Lesion sites associated with neurodegeneration can exhibit an array of gliosis characteristics from glial scarring with reduced astrocyte proliferation to activated, GFAP-positive astrocytes surrounding amyloid plaques (2). Furthermore, the GFAP gene is a target of single nucleotide polymorphisms in the coding region, considered a gain-of-function mutation, characterized by astrocytic inclusions, termed Rosenthal fibers, resulting in Alexander Disease (1-4). GFAP is also a center of many post-translational modifications, such as phosphorylation, which can alter various aspects of filament assembly (1,4).
References
1. Yang, Z., & Wang, K. K. (2015). Glial fibrillary acidic protein: from intermediate filament assembly and gliosis to neurobiomarker. Trends in Neurosciences. https://doi.org/10.1016/j.tins.2015.04.003
2. Hol, E. M., & Capetanaki, Y. (2017). Type III Intermediate Filaments Desmin, Glial Fibrillary Acidic Protein (GFAP), Vimentin, and Peripherin. Cold Spring Harbor Perspectives in Biology. https://doi.org/10.1101/cshperspect.a021642
3. Potokar, M., Morita, M., Wiche, G., & Jorgacevski, J. (2020). The Diversity of Intermediate Filaments in Astrocytes. Cells. https://doi.org/10.3390/cells9071604
4. Viedma-Poyatos, a., Pajares, M. A., & Perez-Sala, D. (2020). Type III intermediate filaments as targets and effectors of electrophiles and oxidants. Redox Biology. https://doi.org/10.1016/j.redox.2020.101582
Long Name
Glial Fibrillary Acidic Protein
Alternate Names
ALXDRD, FLJ45472, GFAP, GFAP astrocytes, glial fibrillary acidic protein
Gene Symbol
GFAP
Additional GFAP Products
Product Documents for GFAP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GFAP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for GFAP Antibody - BSA Free
Customer Reviews for GFAP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GFAP Antibody - BSA Free and earn rewards!
Have you used GFAP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...