GFM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38221

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GFM1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GFM1 Antibody - BSA Free

Western Blot: GFM1 Antibody [NBP2-38221]

Western Blot: GFM1 Antibody [NBP2-38221]

Western Blot: GFM1 Antibody [NBP2-38221] - Analysis using Anti-GFM1 antibody NBP2-38221 (A) shows similar pattern to independent antibody NBP1-83997 (B).
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry: GFM1 Antibody [NBP2-38221]

Immunohistochemistry: GFM1 Antibody [NBP2-38221]

Immunohistochemistry: GFM1 Antibody [NBP2-38221] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining in human placenta and pancreas tissues using anti-GFM1 antibody. Corresponding GFM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human colon.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human lymph node.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human kidney.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human testis.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human kidney, placenta, stomach and testis using Anti-GFM1 antibody NBP2-38221 (A) shows similar protein distribution across tissues to independent antibody NBP1-83997 (B).
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221]

Immunohistochemistry-Paraffin: GFM1 Antibody [NBP2-38221] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Applications for GFM1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFM1

The GFM1 gene codes for a mitochondrial translation elongation factor G where one isoform is 751 amino acids long at around 83 kDA and another isoform is 770 amino acids in length at around 86 kDA. Mitochondrial translation is critical for maintaining mitochondrial function. Mutations may lead to a failure of the respiratory chain-oxidative phosphorylation system and maintenance of mitochondrial DNA will not be successful. GFM1 has been studied in relation to candidiasis, malaria, mycobacterium tuberculosis, hemophilia B, pneumonia, and combined oxidative phosphorylation deficiency. It interacts with TRIM63, SLX4, PRPF4, TRIM55, and SMURF2 to participate in protein biosynthesis and polypeptide chain elongation.

Alternate Names

EFG, EFG1FLJ12662, EFGM, EF-Gmt, EGF1, FLJ13632, FLJ20773, G elongation factor, mitochondrial 1, G translation elongation factor, mitochondrial, GFMCOXPD1, hEFG1, mEF-G 1, mitochondrial, mitochondrial elongation factor G, mitochondrial elongation factor G1

Gene Symbol

GFM1

UniProt

Q96RP9 (Human)

Additional GFM1 Products

Product Documents for GFM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GFM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GFM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFM1 Antibody - BSA Free and earn rewards!

Have you used GFM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies