GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89778

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GFR alpha-2/GDNF R alpha-2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-89778]

Immunohistochemistry-Paraffin: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-89778]

Immunohistochemistry-Paraffin: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-89778] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free [NBP1-89778]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free [NBP1-89778]

Analysis in human thyroid gland tissue.

Applications for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFR alpha-2/GDNF R alpha-2

Members of the glial cell line derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuron survival and differentiation. Physiological responses to NTN require the presence of a novel glycosylphosphadidylinositol linked protein NTNRa, which is a cell surface receptor for NTN. The cDNAs encoding NTNRa from human, rat, chicken, and mouse have been cloned recently. NTNRa was also termed GDNFRb, Ret ligand 2 (RETL2) or TGFb related neurotrophic factor receptor 2 (TrnR2) and nominated as GFRa2 recently. GFRa2 binds NTN and mediates activation of RET receptor tyrosine kinase by both NTN and GDNF. Thus, NTN, GFRa2, and the Ret PTK form a complex to transduce NTN signal and to mediate NTN function.

Long Name

Glial Cell line-derived Neurotrophic Factor Receptor alpha 2

Alternate Names

GDNF R alpha-2, GFR alpha2, GFRa-2, GFRA2

Gene Symbol

GFRA2

Additional GFR alpha-2/GDNF R alpha-2 Products

Product Documents for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

GDNF Family

Customer Reviews for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free and earn rewards!

Have you used GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies