GGA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57436

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GGA2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSPQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GGA2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GGA2 Antibody [NBP2-57436]

Immunocytochemistry/ Immunofluorescence: GGA2 Antibody [NBP2-57436]

Immunocytochemistry/Immunofluorescence: GGA2 Antibody [NBP2-57436] - Staining of human cell line RH-30 shows localization to the Golgi apparatus.

Applications for GGA2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GGA2

GGA2 is a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain that mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins.

Alternate Names

FLJ20966, Gamma-adaptin-related protein 2, golgi associated, gamma adaptin ear containing, ARF binding protein 2, golgi-associated, gamma adaptin ear containing, ARF binding protein 2, Golgi-localized, gamma ear-containing, ARF-binding protein 2, KIAA1080ADP-ribosylation factor-binding protein GGA2, Vear, VHS domain and ear domain of gamma-adaptin, VHS domain and ear domain-containing protein

Gene Symbol

GGA2

Additional GGA2 Products

Product Documents for GGA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GGA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GGA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GGA2 Antibody - BSA Free and earn rewards!

Have you used GGA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies