GilZ Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55645

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GilZ Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH

Reactivity Notes

Mouse 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GilZ Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GilZ Antibody [NBP2-55645]

Immunocytochemistry/ Immunofluorescence: GilZ Antibody [NBP2-55645]

Immunocytochemistry/Immunofluorescence: GilZ Antibody [NBP2-55645] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
GilZ Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: GilZ Antibody - BSA Free [NBP2-55645]

Chromatin Immunoprecipitation-exo-Seq: GilZ Antibody - BSA Free [NBP2-55645]

ChIP-Exo-Seq composite graph for Anti-TSC22D3 (NBP2-55645) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for GilZ Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GilZ

GilZ / TilZ is encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene.

Alternate Names

Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive leucine zipper protein, DSIP-immunoreactive peptide, GILZDKFZp313A1123, Glucocorticoid-induced leucine zipper protein, Protein DIP, TSC22 domain family protein 3, TSC22 domain family, member 3, TSC-22 related protein, TSC-22-like protein, TSC-22-related protein, TSC-22Rimmunoreactor

Gene Symbol

TSC22D3

Additional GilZ Products

Product Documents for GilZ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GilZ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GilZ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GilZ Antibody - BSA Free and earn rewards!

Have you used GilZ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies