GLS2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04094

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all GLS2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 545-602 of human GLS2 (NP_037399.2). NPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GLS2 Antibody - Azide and BSA Free

Western Blot: GLS2 AntibodyAzide and BSA Free [NBP3-04094]

Western Blot: GLS2 AntibodyAzide and BSA Free [NBP3-04094]

Western Blot: GLS2 Antibody [NBP3-04094] - Analysis of extracts of various cell lines, using GLS2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.
GLS2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: GLS2 Antibody - Azide and BSA Free [NBP3-04094] -

Immunocytochemistry/ Immunofluorescence: GLS2 Antibody - Azide and BSA Free [NBP3-04094] - Immunofluorescence analysis of U2OS cells using GLS2 Rabbit pAb (A16029) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Applications for GLS2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GLS2

The protein encoded by the GLS2 gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well. At least one transcribed pseudogene has been found for this gene. [provided by RefSeq]

Alternate Names

EC 3.5.1.2, GAbreast cell glutaminase, GLSglutaminase GA, glutaminase 2 (liver, mitochondrial), glutaminase I, glutaminase liver isoform, mitochondrial, hLGA, LGA, L-glutaminase, L-glutamine amidohydrolase, MGC71567, phosphate-activated glutaminase, phosphate-dependent glutaminase, truncated glutaminase 2

Gene Symbol

GLS2

Additional GLS2 Products

Product Documents for GLS2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GLS2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GLS2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GLS2 Antibody - Azide and BSA Free and earn rewards!

Have you used GLS2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies