GLT25D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90711

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEALPPPTSLDTVPSRDEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GLT25D2 Antibody - BSA Free

Western Blot: GLT25D2 Antibody [NBP1-90711]

Western Blot: GLT25D2 Antibody [NBP1-90711]

Western Blot: GLT25D2 Antibody [NBP1-90711] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: GLT25D2 Antibody [NBP1-90711]

Immunohistochemistry-Paraffin: GLT25D2 Antibody [NBP1-90711]

Immunohistochemistry-Paraffin: GLT25D2 Antibody [NBP1-90711] - Staining of human rectum shows strong granular positivity in glandular cells.
Western Blot: GLT25D2 Antibody [NBP1-90711]

Western Blot: GLT25D2 Antibody [NBP1-90711]

Western Blot: GLT25D2 Antibody [NBP1-90711] - Analysis using Anti-COLGALT2 antibody NBP1-90711 (A) shows similar pattern to independent antibody NBP1-90712 (B).
GLT25D2 Antibody - BSA Free Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Staining of human liver shows negative to very weak positivity in hepatocytes as expected.
GLT25D2 Antibody - BSA Free Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Staining of human duodenum shows strong cytoplasmic granular positivity in glandular cells.
GLT25D2 Antibody - BSA Free Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.
GLT25D2 Antibody - BSA Free Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Immunohistochemistry: GLT25D2 Antibody - BSA Free [NBP1-90711]

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
GLT25D2 Antibody - BSA Free Western Blot: GLT25D2 Antibody - BSA Free [NBP1-90711]

Western Blot: GLT25D2 Antibody - BSA Free [NBP1-90711]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for GLT25D2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GLT25D2

Alternate Names

C1orf17, FLJ37771, FLJ37873, glycosyltransferase 25 domain containing 2, glycosyltransferase 25 family member 2, KIAA0584, procollagen galactosyltransferase 2

Gene Symbol

COLGALT2

Additional GLT25D2 Products

Product Documents for GLT25D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GLT25D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GLT25D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GLT25D2 Antibody - BSA Free and earn rewards!

Have you used GLT25D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...