Glucose 6 phosphate isomerase Antibody (2Y8R0)

Novus Biologicals | Catalog # NBP3-16401

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2Y8R0 expressed in HEK293
View all Glucose 6 phosphate isomerase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glucose 6 phosphate isomerase (P06744). MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glucose 6 phosphate isomerase Antibody (2Y8R0)

Glucose 6 phosphate isomerase Antibody (2Y8R0)

Western Blot: Glucose 6 phosphate isomerase Antibody (2Y8R0) [NBP3-16401] -

Western Blot: Glucose 6 phosphate isomerase Antibody (2Y8R0) [NBP3-16401] - Western blot analysis of lysates from wild type(WT) and glucose-6-phosphateisomerase knockdown (KD) 293T cells, using [KD Validated] Glucose 6 phosphate isomerase Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Glucose 6 phosphate isomerase Antibody (2Y8R0)

Western Blot: Glucose 6 phosphate isomerase Antibody (2Y8R0) [NBP3-16401] -

Western Blot: Glucose 6 phosphate isomerase Antibody (2Y8R0) [NBP3-16401] - Western blot analysis of lysates from HeLa cells, using [KD Validated] glucose-6-phosphateisomerase Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Glucose 6 phosphate isomerase Antibody (2Y8R0)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glucose 6 phosphate isomerase

Glucose 6 phosphate isomerase belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Alternate Names

AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, Neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36

Gene Symbol

GPI

Additional Glucose 6 phosphate isomerase Products

Product Documents for Glucose 6 phosphate isomerase Antibody (2Y8R0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glucose 6 phosphate isomerase Antibody (2Y8R0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glucose 6 phosphate isomerase Antibody (2Y8R0)

There are currently no reviews for this product. Be the first to review Glucose 6 phosphate isomerase Antibody (2Y8R0) and earn rewards!

Have you used Glucose 6 phosphate isomerase Antibody (2Y8R0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies