Glucose 6 phosphate isomerase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58524

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (96%). Backed by our 100% Guarantee.

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glucose 6 phosphate isomerase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glucose 6 phosphate isomerase Antibody - BSA Free

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524]

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524]

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524] - Analysis NBP2-58524 (A) shows similar pattern to independent antibody NBP1-90177 (B).
Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524]

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524]

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524] - Analysis in human cell line A-549 and human cell line SK-MEL-30.

Applications for Glucose 6 phosphate isomerase Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glucose 6 phosphate isomerase

Glucose 6 phosphate isomerase belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Alternate Names

AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, Neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36

Gene Symbol

GPI

Additional Glucose 6 phosphate isomerase Products

Product Documents for Glucose 6 phosphate isomerase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glucose 6 phosphate isomerase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glucose 6 phosphate isomerase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glucose 6 phosphate isomerase Antibody - BSA Free and earn rewards!

Have you used Glucose 6 phosphate isomerase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies