Glut3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89762

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glut3 Antibody - BSA Free

Glut3 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Glut3 Antibody - BSA Free [NBP1-89762]

Immunocytochemistry/ Immunofluorescence: Glut3 Antibody - BSA Free [NBP1-89762]

Staining of human cell line CACO-2 shows localization to plasma membrane.
Glut3 Antibody - BSA Free Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Staining of human testis shows strong membranous positivity in spermatocytes and spermatids.
Glut3 Antibody - BSA Free Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Staining of human small intestine shows no membranous positivity in glandular cells as expected.
Glut3 Antibody - BSA Free Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Staining of human fallopian tube shows no membranous positivity in glandular cells as expected.
Glut3 Antibody - BSA Free Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Immunohistochemistry-Paraffin: Glut3 Antibody - BSA Free [NBP1-89762]

Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Glut3 Antibody - BSA Free

Western Blot: Glut3 Antibody - BSA Free [NBP1-89762] -

High glucose-induced premature senescent HRMECs exhibit diminished glycolysis. (A) Gene Set Enrichment Analysis for Glycolysis gene signature. Transcriptome data from bulk RNA sequencing of three biological replicates of HRMECs cultured with 25 mM D-glucose vs. the 5 mM control at 4 weeks of culture. Gene signature from KEGG Glycolysis was used for the gene set enrichment analysis (GSEA). Heatmaps below depict the leading edges for transcripts responsible for major differences. NES: Normalized Enrichment Score. p adj: adjusted p value. (B) Energy phenotype plot from Seahorse XFe96 analyzer depicting assessment of glycolysis as extracellular acidification rate (ECAR) and mitochondrial respiration as oxygen consumption rate (OCR) at baseline and stressed phenotypes. (C) Glycolysis stress assay to characterize glycolysis in HRMECs under different culture conditions. Injections in the assay were glucose at 20 min, oligomycin at 40 min, and 2-DG at 60 min. (D) Statistical comparison of basal glycolysis measures using Seahorse Glycolysis stress assay in three biological replicates. (E) Western blot analysis to compare expression of glycolysis-related proteins. beta -actin was used as the loading control. *p < 0.05, ns: not significant. One-way ANOVA, with Tukey’s post-hoc analysis was used. C, control in blue; LG in green, 25 mM (+L-glucose); HDG in red, 25 mM (+D-glucose). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36091370), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Glut3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

Reported in scientific literature (PMID 25948295)
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glut3

Glucose is the major source of our energy and there are numerous isoforms of the glucose transporter in mammals, including Glut1, Glut2, Glut3, Glut4, Glut5, Glut6, Glut7, Glut8 and Glut9. The Glut5 gene located on the short arm of human chromosome 1 encodes a 501-amino acid facilitative glucose transporter. Glut5 mRNA is highly expressed in small intestine and to a lesser extent in kidney, skeletal muscle and adipose tissue. Glut5 plays a critical role in fructose absorption in the small intestine and its expression is highly induced when exposed to a fructose-enriched diet. Glut5 transporter expressed in human skeletal muscle is specifically localized to the plasma membrane, where it participates in regulating hexose transfer across the sarcolemma. Glut8, a novel glucose transporter-like protein, exhibits significant sequence similarity with the other members of sugar transporter family. Glut8 comprises 12 putative membrane-spanning helices and several conserved motifs, which are important for transport activity. In human tissues, Glut8 is predominantly expressed in testis and, to a lesser extent, in most other tissues including skeletal muscle, heart, small intestine and brain. In addition, the Glut8 glucose transport facilitator has a hormonally regulated testicular function.

Long Name

Glucose Transporter Type 3

Alternate Names

SLC2A3

Entrez Gene IDs

6515 (Human)

Gene Symbol

SLC2A3

UniProt

Additional Glut3 Products

Product Documents for Glut3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glut3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Glut3 Antibody - BSA Free

Customer Reviews for Glut3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glut3 Antibody - BSA Free and earn rewards!

Have you used Glut3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...