Glutathione S Transferase kappa 1 Antibody (7J5B3)
Novus Biologicals | Catalog # NBP3-16857
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7J5B3 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Glutathione S Transferase kappa 1 (Q9Y2Q3). MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAM
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Glutathione S Transferase kappa 1 Antibody (7J5B3)
Western Blot: Glutathione S Transferase kappa 1 Antibody (7J5B3) [NBP3-16857]
Western Blot: Glutathione S Transferase kappa 1 Antibody (7J5B3) [NBP3-16857] - Western blot analysis of extracts of various cell lines, using Glutathione S Transferase kappa 1 Rabbit mAb (NBP3-16857) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.Immunocytochemistry/ Immunofluorescence: Glutathione S Transferase kappa 1 Antibody (7J5B3) [NBP3-16857]
Immunocytochemistry/Immunofluorescence: Glutathione S Transferase kappa 1 Antibody (7J5B3) [NBP3-16857] - Immunofluorescence analysis of NIH-3T3 cells using Glutathione S Transferase kappa 1 Rabbit mAb (NBP3-16857) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for Glutathione S Transferase kappa 1 Antibody (7J5B3)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Glutathione S Transferase kappa 1
Alternate Names
EC 2.5.1.18, glutathione S-transferase k1, glutathione S-transferase kappa 1, Glutathione S-transferase subunit 13, glutathione S-transferase subunit 13 homolog, GST, GST 13-13, GST class-kappa, GST13, GST13-13, GSTK1-1, hGSTK1
Gene Symbol
GSTK1
Additional Glutathione S Transferase kappa 1 Products
Product Documents for Glutathione S Transferase kappa 1 Antibody (7J5B3)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Glutathione S Transferase kappa 1 Antibody (7J5B3)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Glutathione S Transferase kappa 1 Antibody (7J5B3)
There are currently no reviews for this product. Be the first to review Glutathione S Transferase kappa 1 Antibody (7J5B3) and earn rewards!
Have you used Glutathione S Transferase kappa 1 Antibody (7J5B3)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...