Glutathione S-transferase Mu 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35584

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glutathione S-transferase Mu 5 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human Glutathione S-transferase Mu 5 (NP_000842.2).

Sequence:
LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glutathione S-transferase Mu 5 Antibody - BSA Free

Glutathione S-transferase Mu 5 Antibody

Western Blot: Glutathione S-transferase Mu 5 Antibody [NBP3-35584] -

Western Blot: Glutathione S-transferase Mu 5 Antibody [NBP3-35584] - Western blot analysis of various lysates using Glutathione S-transferase Mu 5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for Glutathione S-transferase Mu 5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione S-transferase Mu 5

The GSTM5 (glutathione S-transferase Mu 5) gene codes for a 218 amino acid long, 25 kDA protein that functions as a catalyst in various reactions in eukaryotes and prokaryotes such as converting reduced gluthathione to a large number of exogenous and endogenous hydrophobic electrophiles. GSTM5 has been linked to various diseases such as hypertension, hepatitis, adenocarcinoma, breast cancer, coronary heart disease, and hypertension. GSTM5 participates in gluthione metabolism and conjugation as well as metapathway biotransformation and has been known to interact with various genes such as CYP1A1, CYP1B1, CYP2B6, CYP2C19, and ALDH1A3.

Alternate Names

EC 2.5.1.18, glutathione S-alkyltransferase M5, glutathione S-aralkyltransferase M5, glutathione S-aryltransferase M5, glutathione S-transferase M5, glutathione S-transferase mu 5, GST class-mu 5, GSTM5-5, GTM5, S-(hydroxyalkyl)glutathione lyase M5

Gene Symbol

GSTM5

Additional Glutathione S-transferase Mu 5 Products

Product Documents for Glutathione S-transferase Mu 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glutathione S-transferase Mu 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutathione S-transferase Mu 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione S-transferase Mu 5 Antibody - BSA Free and earn rewards!

Have you used Glutathione S-transferase Mu 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies