GlyT2/SLC6A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86653

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GlyT2/SLC6A5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human GlyT2/SLC6A5. Peptide sequence: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GlyT2/SLC6A5 Antibody - BSA Free

Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653]

Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653]

Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - Host: Rabbit. Target Name: SLC6A5. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653]

Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653]

Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653] - Rabbit Anti-SLC6A5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody
Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653]

Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653]

Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mL. Sample Type: Human heart

Applications for GlyT2/SLC6A5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GlyT2/SLC6A5

SLC6A5 - solute carrier family 6 (neurotransmitter transporter, glycine), member 5

Long Name

Sodium- And Chloride-Dependent Glycine Transporter 2

Alternate Names

Glycine Transporter-2, HKPX3, SLC6A5

Gene Symbol

SLC6A5

Additional GlyT2/SLC6A5 Products

Product Documents for GlyT2/SLC6A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GlyT2/SLC6A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GlyT2/SLC6A5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GlyT2/SLC6A5 Antibody - BSA Free and earn rewards!

Have you used GlyT2/SLC6A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies