GNPDA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33474

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GNPDA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GNPDA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474] - Staining of human testis shows strong cytoplasmic positivity in leydig cells and cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474]

Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-33474] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Applications for GNPDA1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNPDA1

GNPDA1, also known as Glucosamine-6-phosphate isomerase 1, is a 289 amino acid that is 33 kDa, with homohexamer subunit structure and cytoplasm location; is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium; and appears to trigger calcium oscillations in mammalian eggs which operate as the basic trigger for egg activation and early development of the embryo. Disease research is currently being studied with relation to GNPDA1 and lipoid nephrosis, hepatocellular carcinoma, and acute interstitial pneumonia. The protein has been linked to the amino sugar and nucleotide sugar metabolism and metabolic pathways where it interacts with MCC, EWSR1, ILF2, AMDHD2, and GP1.

Alternate Names

EC 3.5.99.6, GlcN6P deaminase 1, glucosamine-6-phosphate deaminase 1KIAA0060HLNGNPIGNPDA, glucosamine-6-phosphate isomerase, glucosamine-6-phosphate isomerase 1, GNP1, GNPDA 1, GPI, oscillin

Gene Symbol

GNPDA1

UniProt

Q8TDQ7 (Human)

Additional GNPDA1 Products

Product Documents for GNPDA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GNPDA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNPDA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GNPDA1 Antibody - BSA Free and earn rewards!

Have you used GNPDA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies