GP2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86061
![Immunocytochemistry/ Immunofluorescence: GP2 Antibody [NBP1-86061]](https://beta-resources.rndsystems.com/images/products/GP2-Antibody-Immunohistochemistry-NBP1-86061-img0007.jpg "Immunocytochemistry/ Immunofluorescence: GP2 Antibody [NBP1-86061]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit GP2 Antibody - BSA Free (NBP1-86061) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-GP2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for GP2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: GP2 Antibody [NBP1-86061]
Immunocytochemistry/Immunofluorescence: GP2 Antibody [NBP1-86061] - Staining GP2 in frozen human pancreatic sections using anti-GP2 antibody. GP2 stains primarily exocrine tissue in human pancreas. Image from verified customer review.![GP2 Antibody - BSA Free Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]](https://beta-resources.rndsystems.com/images/products/nbp1-86061_rabbit-polyclonal-gp2-antibody-23420251573957.jpg "Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]")
Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]
Staining of human skeletal muscle shows no positivity in myocytes as expected.![GP2 Antibody - BSA Free Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]](https://beta-resources.rndsystems.com/images/products/nbp1-86061_rabbit-polyclonal-gp2-antibody-23420251592514.jpg "Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]")
Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]
Staining of human tonsil shows no positivity in non-germinal center cells as expected.![GP2 Antibody - BSA Free Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]](https://beta-resources.rndsystems.com/images/products/nbp1-86061_rabbit-polyclonal-gp2-antibody-23420251573951.jpg "Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]")
Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]
Staining of human liver shows no positivity in hepatocytes as expected.![GP2 Antibody - BSA Free Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]](https://beta-resources.rndsystems.com/images/products/nbp1-86061_rabbit-polyclonal-gp2-antibody-24420259342942.jpg "Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]")
Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]
Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using HPA016668 antibody. Corresponding GP2 RNA-seq data are presented for the same tissues.![GP2 Antibody - BSA Free Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]](https://beta-resources.rndsystems.com/images/products/nbp1-86061_rabbit-polyclonal-gp2-antibody-24420259402471.jpg "Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]")
Immunohistochemistry-Paraffin: GP2 Antibody - BSA Free [NBP1-86061]
Staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.Applications for GP2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
Validated from a verified customer review
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 4 using NBP1-86061 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GP2/ZAP75
Long Name
Glycoprotein 2
Alternate Names
GP2, ZAP75
Gene Symbol
GP2
Additional GP2/ZAP75 Products
Product Documents for GP2 Antibody - BSA Free
Product Specific Notices for GP2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for GP2 Antibody - BSA Free
Powered by Bioz
Customer Reviews for GP2 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used GP2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: ImmunofluorescenceSample Tested:Species: HumanVerified Customer | Posted 02/15/2016GP2 Stains primarily Exocrine tissue in human pancreas.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...