GPD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86121

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GPD2 Antibody - BSA Free

Western Blot: GPD2 Antibody [NBP1-86121]

Western Blot: GPD2 Antibody [NBP1-86121]

Western Blot: GPD2 Antibody [NBP1-86121] - Staining of human colon, liver, parathyroid gland and skin using Anti-GPD2 antibody NBP1-86121 (A) shows similar protein distribution across tissues to independent antibody NBP2-38542 (B).
Western Blot: GPD2 Antibody [NBP1-86121]

Western Blot: GPD2 Antibody [NBP1-86121]

Western Blot: GPD2 Antibody [NBP1-86121] - Analysis using Anti-GPD2 antibody NBP1-86121 (A) shows similar pattern to independent antibody NBP2-38542 (B).
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Staining of human liver shows negative to very weak cytoplasmic granular positivity in hepatocytes.
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Staining of human gastrointestinal, liver, prostate and squamous epithelia using Anti-GPD2 antibody NBP1-86121 (A) shows similar protein distribution across tissues to independent antibody NBP2-38542 (B).
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Staining of human prostate shows strong cytoplasmic granular positivity in glandular cells.
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Staining of human skin shows strong cytoplasmic granular positivity in squamous epithelial cells.
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Staining of human parathyroid gland shows strong cytoplasmic granular positivity in glandular cells.
GPD2 Antibody - BSA Free Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry-Paraffin: GPD2 Antibody - BSA Free [NBP1-86121]

Immunohistochemistry analysis in human parathyroid gland and liver tissues using HPA008012 antibody. Corresponding GPD2 RNA-seq data are presented for the same tissues.
GPD2 Antibody - BSA Free Western Blot: GPD2 Antibody - BSA Free [NBP1-86121]

Western Blot: GPD2 Antibody - BSA Free [NBP1-86121]

Analysis in human cell line CACO-2.

Applications for GPD2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPD2

Mitochondrial glycerophosphate dehydrogenase (EC 1.1.99.5), or GPD2, is located on the outer surface of the inner mitochondrial membrane and catalyzes the unidirectional conversion of glycerol-3-phosphate (G-3-P) to dihydroxyacetone phosphate (DHAP) with concomitant reduction of the enzyme-bound FAD. Together with a cytosolic NAD-linked GPD (GPD1; MIM 138420), GPD2 forms the glycerol phosphate shuttle, which uses the interconversion of G-3-P and DHAP to transfer reducing equivalents into mitochondria, resulting in the reoxidation of NADH formed during glycolysis.[supplied by OMIM]

Long Name

Glycerol-3-phosphate dehydrogenase, mitochondrial

Alternate Names

EC 1.1.5.3, GPD-M, GPDH-M, mGDH, mtGPD

Gene Symbol

GPD2

Additional GPD2 Products

Product Documents for GPD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GPD2 Antibody - BSA Free

Customer Reviews for GPD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPD2 Antibody - BSA Free and earn rewards!

Have you used GPD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...