GPR107 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83629

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GPR107 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GPR107 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Analysis in human prostate and liver tissues. Corresponding GPR107 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Staining of human cerebral cortex shows strong positivity in Golgi apparatus in neurons.
Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody [NBP1-83629] - Staining of human Fallopian tube shows strong positivity in Golgi apparatus in glandular cells.
GPR107 Antibody - BSA Free Immunohistochemistry-Paraffin: GPR107 Antibody - BSA Free [NBP1-83629]

Immunohistochemistry-Paraffin: GPR107 Antibody - BSA Free [NBP1-83629]

Staining of human prostate shows strong positivity in Golgi apparatus in glandular cells.

Applications for GPR107 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR107

The GPR107 gene encodes protein GPR107 that in isoform 1 is 600 amino acids long, 66 kDA, in isoform 2 is 552 amino acids long, 61 KDA, and in isoform 3 is 300 amino acids long, 33 kDA. GPR107 is known to interact with the gene UBC. It has been researched regarding its role in nail-patella syndrome, basal cell carcinoma, spina bifida, and focal dermal hypoplasia.

Long Name

G Protein-coupled Receptor 107

Alternate Names

BA138E2.2, KIAA1624, LUSTR1

Gene Symbol

GPR107

Additional GPR107 Products

Product Documents for GPR107 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GPR107 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR107 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR107 Antibody - BSA Free and earn rewards!

Have you used GPR107 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies