GPR12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09437

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR12 (NP_005279). Peptide sequence SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GPR12 Antibody - BSA Free

Western Blot: GPR12 Antibody [NBP3-09437]

Western Blot: GPR12 Antibody [NBP3-09437]

Western Blot: GPR12 Antibody [NBP3-09437] - Western blot analysis of GPR12 in Fetal Liver as a positive control. Antibody dilution at 1.0 ug/ml

Applications for GPR12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR12

GPCR GPR12 is a G protein coupled receptor. A variety of extracellular signals are transmitted into cells through integral membrane receptors coupled to heterotrimeric G proteins. Such G protein coupled receptors are critical for the normal functions of many cell types: neurons, endocrine cells, cardiac and smooth muscle cells, and sensory cells for detection of light, taste, and smell. Both activating and loss of function mutations in G protein coupled receptors have been found as the cause of human diseases. The GPR12 gene is located on human chromosome 13q12. GPR12 expression has been reported primarily in the central nervous system. Rat transcripts have been identified at low levels in testis and pituitary gland. ESTs have been isolated from human brain and eye libraries, as well as mouse brain.

Long Name

G Protein-coupled Receptor 12

Alternate Names

GPCR12, GPCR21

Gene Symbol

GPR12

Additional GPR12 Products

Product Documents for GPR12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bioactive Lipids and Receptors

Customer Reviews for GPR12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR12 Antibody - BSA Free and earn rewards!

Have you used GPR12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies