Granulin Antibody (4R8W1)

Novus Biologicals | Catalog # NBP3-33412

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 4R8W1
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 494-593 of human Granulin (NP_002078.1).

Sequence:
SCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Granulin Antibody (4R8W1)

Granulin Antibody (4R8W1)

Western Blot: Granulin Antibody (4R8W1) [NBP3-33412] -

Western Blot: Granulin Antibody (4R8W1) [NBP3-33412] - Western blot analysis of lysates from Mouse liver, using Granulin Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Granulin Antibody (4R8W1)

Western Blot: Granulin Antibody (4R8W1) [NBP3-33412] -

Western Blot: Granulin Antibody (4R8W1) [NBP3-33412] - Western blot analysis of lysates from HeLa cells, using Granulin Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Granulin Antibody (4R8W1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Granulin

Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.

Alternate Names

acrogranin, GEP, GP88, granulin, granulin-epithelin, granulins, PC cell-derived growth factor, PCDGF, PEPI, PGRN, Proepithelin, progranulin

Gene Symbol

GRN

Additional Granulin Products

Product Documents for Granulin Antibody (4R8W1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Granulin Antibody (4R8W1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Granulin Antibody (4R8W1)

There are currently no reviews for this product. Be the first to review Granulin Antibody (4R8W1) and earn rewards!

Have you used Granulin Antibody (4R8W1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...