Granzyme K Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49387

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Granzyme K Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Granzyme K Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Analysis in human tonsil and cerebral cortex tissues. Corresponding Granzyme K RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human spleen shows strong granular cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human rectum shows weak granular cytoplasmic positivity in leukocytes.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Granzyme K Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP2-49387 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Granzyme K

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H localizes to cytoplasmic granules of cytolytic T lymphocytes and is important for target cell lysis in cell-mediated immune responses. Granzyme K (GMZK), also designated granzyme-3 or NK-tryptase-2 (NK-TRYP-2), contains one peptidase S1 domain. Granzyme K is a serine protease localizing to the granules of natural killer cells and cytotoxic T lymphocytes. It is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Alternate Names

Fragmentin-3, Granzyme 3, Granzyme-K, GZMK, NK-Tryp-2, NK-Tryptase-2, TRYP2, Tryptase II

Gene Symbol

GZMK

Additional Granzyme K Products

Product Documents for Granzyme K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Granzyme K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Granzyme K Antibody - BSA Free

Customer Reviews for Granzyme K Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Granzyme K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Granzyme K Antibody
    Name: Anonymous
    Application: Immunohistochemistry
    Sample Tested: human skin
    Species: Human
    Verified Customer | Posted 06/16/2017
    Granzyme K Antibody - BSA Free NBP2-49387

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies