Granzyme K Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17052

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Granzyme K Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Granzyme K Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052] - Analysis in human lymph node and duodenum tissues using Anti-GZMK antibody. Corresponding GZMK RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052]

Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP3-17052] - Staining of human lymph node shows high expression.

Applications for Granzyme K Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Granzyme K

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H localizes to cytoplasmic granules of cytolytic T lymphocytes and is important for target cell lysis in cell-mediated immune responses. Granzyme K (GMZK), also designated granzyme-3 or NK-tryptase-2 (NK-TRYP-2), contains one peptidase S1 domain. Granzyme K is a serine protease localizing to the granules of natural killer cells and cytotoxic T lymphocytes. It is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Alternate Names

Fragmentin-3, Granzyme 3, Granzyme-K, GZMK, NK-Tryp-2, NK-Tryptase-2, TRYP2, Tryptase II

Gene Symbol

GZMK

Additional Granzyme K Products

Product Documents for Granzyme K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Granzyme K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Granzyme K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Granzyme K Antibody - BSA Free and earn rewards!

Have you used Granzyme K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies