GRP78/HSPA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89968

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK

Marker

ER Stress Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GRP78/HSPA5 Antibody - BSA Free

GRP78/HSPA5 Antibody - BSA Free Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody [NBP1-89968] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
GRP78/HSPA5 Antibody - BSA Free Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
GRP78/HSPA5 Antibody - BSA Free Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Immunohistochemistry-Paraffin: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
GRP78/HSPA5 Antibody - BSA Free Western Blot: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Western Blot: GRP78/HSPA5 Antibody - BSA Free [NBP1-89968]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: GRP78/HSPA5 Antibody [NBP1-89968]

Western Blot: GRP78/HSPA5 Antibody [NBP1-89968]

Western Blot: GRP78/HSPA5 Antibody [NBP1-89968] - Analysis using Anti-HSPA5 antibody NBP1-89968 (A) shows similar pattern to independent antibody NBP1-89969 (B).

Applications for GRP78/HSPA5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRP78/HSPA5

Within the ER, misfolded proteins are detected by Bip (GPR78). In the presence of misfolded proteins, GPR78 disscociates from PERK, allowing it to homodimerize and autophosphoyate. In its dimerized phosphorylated form, PERK phosphorylates eIF2. The phosphorylation of eIF2 blocks the majority of translation to prevent the continued accumulation of protein in the ER. GRP78 also binds to IRE1 and ATF6 under normal ER conditions, but dissociates upon accumulation of misfolded proteins. Unbound ATF6 is translocated to the gogli where it is converted into a cleaved, active form. The cleaved form of ATF6 is then able to up regulate transcription of UPR genes including XBP1. Activated IRE1 acts as an endoribonuclease to an intron from XBP1 transcripts. The XBP1 splice variant codes for an active transcription factor which activates transcription of P58IPK. P58IPK is a HSP40 protein which binds to and inhibits PERK. Thus, if the accumulated misfolded proteins have been removed, P58IPK acts to shut down the UPR by removing the block to translation.

Long Name

75 KD Glucose Regulated Protein

Alternate Names

BIP, HSP70-5, HSPA5

Gene Symbol

HSPA5

Additional GRP78/HSPA5 Products

Product Documents for GRP78/HSPA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GRP78/HSPA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRP78/HSPA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRP78/HSPA5 Antibody - BSA Free and earn rewards!

Have you used GRP78/HSPA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...