GSTA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46817

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GSTA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GSTA1 Antibody - BSA Free

Western Blot: GSTA1 Antibody [NBP2-46817]

Western Blot: GSTA1 Antibody [NBP2-46817]

Western Blot: GSTA1 Antibody [NBP2-46817] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma, Lane 5: Human Analysis of human liver tissue.
Immunocytochemistry/ Immunofluorescence: GSTA1 Antibody [NBP2-46817]

Immunocytochemistry/ Immunofluorescence: GSTA1 Antibody [NBP2-46817]

Immunocytochemistry/Immunofluorescence: GSTA1 Antibody [NBP2-46817] - Staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry: GSTA1 Antibody [NBP2-46817]

Immunohistochemistry: GSTA1 Antibody [NBP2-46817]

Immunohistochemistry: GSTA1 Antibody [NBP2-46817] - Staining of human Analysis of human liver tissue. shows strong cytoplasmic and nuclear positivity in hepatocytes.

Applications for GSTA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTA1

GSTA1 is glutathione S-transferase which are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Long Name

Glutathione S-transferase A1

Alternate Names

EC 1.11.1.-, EC 2.5.1.18, EC 5.3.3.-, GST HA subunit 1, GST-epsilon, GSTA1-1

Entrez Gene IDs

2938 (Human)

Gene Symbol

GSTA1

UniProt

P08263 (Human)

Additional GSTA1 Products

Product Documents for GSTA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GSTA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSTA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSTA1 Antibody - BSA Free and earn rewards!

Have you used GSTA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies