GTF2A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55408

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GTF2A2 Antibody - BSA Free

Western Blot: GTF2A2 Antibody [NBP2-55408]

Western Blot: GTF2A2 Antibody [NBP2-55408]

Western Blot: GTF2A2 Antibody [NBP2-55408] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: GTF2A2 Antibody [NBP2-55408]

Immunocytochemistry/ Immunofluorescence: GTF2A2 Antibody [NBP2-55408]

Immunocytochemistry/Immunofluorescence: GTF2A2 Antibody [NBP2-55408] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
GTF2A2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: GTF2A2 Antibody - BSA Free [NBP2-55408]

Chromatin Immunoprecipitation-exo-Seq: GTF2A2 Antibody - BSA Free [NBP2-55408]

ChIP-Exo-Seq composite graph for Anti-GTF2A2 (NBP2-55408) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for GTF2A2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF2A2

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM]

Alternate Names

General transcription factor IIA subunit 2, general transcription factor IIA, 2 (12kD subunit), general transcription factor IIA, 2, 12kDa, HsT18745, TF2A2, TFIIA, TFIIA p12 subunit, TFIIA-12, TFIIA-gamma, TFIIAS, Transcription initiation factor IIA gamma chain, transcription initiation factor IIA subunit 2

Gene Symbol

GTF2A2

Additional GTF2A2 Products

Product Documents for GTF2A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTF2A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF2A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF2A2 Antibody - BSA Free and earn rewards!

Have you used GTF2A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...