GTF3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38541

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GTF3A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF3A (NP_002088.2).

Sequence:
MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPFVCDYEGCGKAFIRDYHLSRHILTHTGEKPF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GTF3A Antibody - BSA Free

GTF3A Antibody

Western Blot: GTF3A Antibody [NBP3-38541] -

Western Blot: GTF3A Antibody [NBP3-38541] - Western blot analysis of lysates from 293F cells, using GTF3A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for GTF3A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GTF3A

The GTF3A gene encodes a zinc finger protein with nine Cis(2)-His(2) domains that interacts with the internal control region (ICR) of approximately 50 bases within 5S RNA genes. This is where it works as a RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The proteins coded by the GTF3A gene also play a role in regulating the stability of transcription of other genes. The GTF3A gene exists in two isoforms: isoform 1 is 365 amino acids long at 41 kDA while isoform 2 is 340 amino acids long at 38 kDA. GTF3A has been investigated in its role in apnea, glaucoma, digeorge syndrome, acute liver failure, and endocarditis. GTF3A participates in RNA polymerase III transcription and interacts with genes ABL1, FYN, CXCR2, GTF3C2, and EPN1.

Alternate Names

general transcription factor IIIA, TFIIIAAP2, transcription factor IIIA

Gene Symbol

GTF3A

Additional GTF3A Products

Product Documents for GTF3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GTF3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF3A Antibody - BSA Free and earn rewards!

Have you used GTF3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies