GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

Novus Biologicals | Catalog # H00009567-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1H1

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV

Reactivity Notes

Human. Other species not tested.

Specificity

GTP binding protein 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

Western Blot: GTP-binding protein 1 Antibody (1H1) [H00009567-M01]

Western Blot: GTP-binding protein 1 Antibody (1H1) [H00009567-M01]

Western Blot: GTP-binding protein 1 Antibody (1H1) [H00009567-M01] - Analysis of GTPBP1 expression in transfected 293T cell line by GTPBP1 monoclonal antibody (M01), clone 1H1.Lane 1: GTPBP1 transfected lysate(63.4 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: GTP-binding protein 1 Antibody (1H1) [H00009567-M01]

Immunoprecipitation: GTP-binding protein 1 Antibody (1H1) [H00009567-M01]

Immunoprecipitation: GTP-binding protein 1 Antibody (1H1) [H00009567-M01] - Analysis of GTPBP1 transfected lysate using anti-GTPBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GTPBP1 monoclonal antibody.

Applications for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GTP-binding protein 1

This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype.

Alternate Names

GP1GTP-binding protein 1, GP-1MGC20069, G-protein 1, GTP binding protein 1, HSPC018

Entrez Gene IDs

9567 (Human)

Gene Symbol

GTPBP1

OMIM

602245 (Human)

Additional GTP-binding protein 1 Products

Product Documents for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free and earn rewards!

Have you used GTP-binding protein 1 Antibody (1H1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...