Guanylyl Cyclase beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24889

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Guanylyl Cyclase beta 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Guanylyl Cyclase beta 1 using the following amino acid sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Guanylyl Cyclase beta 1 Antibody - BSA Free

Guanylyl Cyclase beta 1 Antibody Immunocytochemistry/Immunofluorescence: Guanylyl Cyclase beta 1 Antibody [NBP3-24889]

Immunocytochemistry/Immunofluorescence: Guanylyl Cyclase beta 1 Antibody [NBP3-24889]

Staining of human cell line HEL shows localization to cytosol.

Applications for Guanylyl Cyclase beta 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Guanylyl Cyclase beta 1

Guanylate Cyclase is an heterodimer of an alpha and a beta chain. Its enzymatic activity transforms GTP to GMP releasing a diphosphate. It binds 1 or 2 hemes per heterodimer. It is activated by nitric oxide in the presence of magnesium or manganese ions. There are two types of guanylate cyclase: soluble form and membrane-associated receptor form.

Alternate Names

EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit

Gene Symbol

GUCY1B1

Additional Guanylyl Cyclase beta 1 Products

Product Documents for Guanylyl Cyclase beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Guanylyl Cyclase beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Guanylyl Cyclase beta 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Guanylyl Cyclase beta 1 Antibody - BSA Free and earn rewards!

Have you used Guanylyl Cyclase beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies