GUCY2C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81788

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GUCY2C Antibody - BSA Free

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788]

Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human liver shows no positivity in hepatocyes as expected.

Applications for GUCY2C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Guanylyl Cyclase C/GUCY2C

Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.

Alternate Names

DIAR6, GC-C, GCC, Guanylate Cyclase C, GUC2C, GUCY2C, MUCIL, STA Receptor, StAR

Gene Symbol

GUCY2C

Additional Guanylyl Cyclase C/GUCY2C Products

Product Documents for GUCY2C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GUCY2C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GUCY2C Antibody - BSA Free

Customer Reviews for GUCY2C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GUCY2C Antibody - BSA Free and earn rewards!

Have you used GUCY2C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GUCY2C Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Does GUCY2C Antibody 0.1 ml have any potential IP issues?

    A: It looks like by IP you meant Intellectual Property, and NO, we do not know of any IP issues with this product.

  • Q: Does this human Gucy2c antibody cross react with mouse?

    A: Based on the immunogen sequence used the antibody has about 79% homology with mouse. We typically do not recommend anything that is below 85% for testing as there is not as great of a chance it will work. Especially with this one where their are lots of glycosylation sites and the amino acids that differ are spread out. Since it is polyclonal though there may be a chance since it isn't binding just one location, although the affinity may be lower so concentration might need to be increased. We have not yet tested in mouse, so it will be up to your discretion if you wish to try this one out, or not as we cannot guarantee it. For future reference if you wish to know is something is predicted not to work in a particular species or application we will list it with a (-) next to it. Such as Mu (-). If it has not been tested we will leave it blank.

  • Q: Does GUCY2C Antibody 0.1 ml have any potential IP issues?

    A: It looks like by IP you meant Intellectual Property, and NO, we do not know of any IP issues with this product.

  • Q: Does this human Gucy2c antibody cross react with mouse?

    A: Based on the immunogen sequence used the antibody has about 79% homology with mouse. We typically do not recommend anything that is below 85% for testing as there is not as great of a chance it will work. Especially with this one where their are lots of glycosylation sites and the amino acids that differ are spread out. Since it is polyclonal though there may be a chance since it isn't binding just one location, although the affinity may be lower so concentration might need to be increased. We have not yet tested in mouse, so it will be up to your discretion if you wish to try this one out, or not as we cannot guarantee it. For future reference if you wish to know is something is predicted not to work in a particular species or application we will list it with a (-) next to it. Such as Mu (-). If it has not been tested we will leave it blank.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...