HAND2 Antibody (4D9) - Azide and BSA Free

Novus Biologicals | Catalog # H00009464-M05

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4D9

Format

Azide and BSA Free
View all HAND2 Primary Antibodies »

Product Specifications

Immunogen

HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK

Specificity

HAND2 (4D9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Novus Biologicals Mouse HAND2 Antibody (4D9) - Azide and BSA Free (H00009464-M05) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HAND2 Antibody (4D9) - Azide and BSA Free

Western Blot: HAND2 Antibody (4D9) [H00009464-M05]

Western Blot: HAND2 Antibody (4D9) [H00009464-M05]

Western Blot: HAND2 Antibody (4D9) [H00009464-M05] - Analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M05), clone 4D9. Lane 1: HAND2 transfected lysatE (21.6 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: HAND2 Antibody (4D9) [H00009464-M05]

Immunocytochemistry/ Immunofluorescence: HAND2 Antibody (4D9) [H00009464-M05]

Immunocytochemistry/Immunofluorescence: HAND2 Antibody (4D9) [H00009464-M05] - Analysis of monoclonal antibody to HAND2 on HeLa cell. Antibody concentration 10 ug/ml

Applications for HAND2 Antibody (4D9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HAND2

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development.

Long Name

Heart And Neural Crest Derivatives Expressed 2

Alternate Names

dHand, Ehand2, Hed, Th2, Thing2

Entrez Gene IDs

9464 (Human)

Gene Symbol

HAND2

OMIM

602407 (Human)

UniProt

NP_068808 (Human)

Additional HAND2 Products

Product Documents for HAND2 Antibody (4D9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HAND2 Antibody (4D9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAND2 Antibody (4D9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HAND2 Antibody (4D9) - Azide and BSA Free and earn rewards!

Have you used HAND2 Antibody (4D9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies