HDLBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24896

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HDLBP Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein HDLBP using the following amino acid sequence: LHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HDLBP Antibody - BSA Free

HDLBP Antibody Immunocytochemistry/Immunofluorescence: HDLBP Antibody [NBP3-24896]

Immunocytochemistry/Immunofluorescence: HDLBP Antibody [NBP3-24896]

Staining of human cell line hTERT-RPE1 shows localization to endoplasmic reticulum.

Applications for HDLBP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HDLBP

HDL-binding protein 1 (HDLBP) is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel or to adipose tissue for energy storage. Triglycerides are broken down or hydrolyzed by the enzyme lipoprotein lipase (LpL). The triglyceride breakdown products are then taken up and used by cells. HDLBP is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of HDLBP.

Alternate Names

HBPFLJ16432, HDL-binding protein, high density lipoprotein binding protein, High density lipoprotein-binding protein, PRO2900, VGLvigilin

Gene Symbol

HDLBP

Additional HDLBP Products

Product Documents for HDLBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HDLBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HDLBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HDLBP Antibody - BSA Free and earn rewards!

Have you used HDLBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies