Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-69063

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP2-69063]

Immunocytochemistry/ Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP2-69063]

Immunocytochemistry/Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody [NBP2-69063] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane. Antibody staining is shown in green.

Applications for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3

Heparan sulfate is a highly sulfated polysaccharide that can be found on the cell surface and extracellular matrix. It is usually covalently attached to a protein core as the glycan component of a proteoglycan. Heparan sulfate interacts with a variety of proteins, such as growth factors, protease inhibitors, cytokines, lipoprotein lipase and viral envelope proteins, therefore playing roles in cell growth, cell differentiation, cell motility, blood coagulation, lipid metabolism and viral infection. Heparan sulfate consists of repeating residues of uronic acid and N-acetylglucosamine. The uronic acid residues can be sulfated at the 2-O position by heparan sulfate 2-O-sulfotransferase. The N-acetylglucosamine residues can be sulfated at N-, 3-O, and 6-O positions by N-deacetylase/N-sulfotransferases, heparan sulfate 3-O- and 6-O-sulfotransferases, respectively. However, the reactions catalyzed by these sulfotransferases are normally incomplete on the whole chain of heparan sulfate. As a result, heparan sulfate displays enormous sequence diversity that allows it to interact with a wide spectrum of proteins differently. Three heparan sulfate 6-O-sulfotransferases are found both in human and mouse possibly with overlapping substrate specificity. HS6ST3 is ubiquitously expressed while HS6ST1 and HS6ST2 are expressed primarily in the liver and brain/spleen, respectively. Mouse HS6ST3 has 94% amino acid sequence identity with the human ortholog.

Alternate Names

DKFZp761K2315, heparan sulfate 6-O-sulfotransferase 3

Gene Symbol

HS6ST3

Additional Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Products

Product Documents for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free and earn rewards!

Have you used Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail