Hexokinase 2 Antibody (5Z8C3)

Novus Biologicals | Catalog # NBP3-33349

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5Z8C3
View all Hexokinase 2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase 2 (NP_000180.2).

Sequence:
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

102 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hexokinase 2 Antibody (5Z8C3)

Hexokinase 2 Antibody (5Z8C3)

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] -

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] - Western blot analysis of various lysates using [KO Validated] Hexokinase 2 Rabbit mAb at 1:25000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Hexokinase 2 Antibody (5Z8C3)

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] -

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] - Western blot analysis of lysates from Mouse skeletal muscle using [KO Validated] Hexokinase 2 Rabbit mAb at 1:25000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Hexokinase 2 Antibody (5Z8C3)

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] -

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] - Western blot analysis of various lysates using [KO Validated] Hexokinase 2 Rabbit mAb at 1:25000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Hexokinase 2 Antibody (5Z8C3)

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] -

Western Blot: Hexokinase 2 Antibody (5Z8C3) [NBP3-33349] - Western blot analysis of lysates from Mouse skeletal muscle using [KO Validated] Hexokinase 2 Rabbit mAb at 1:25000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Hexokinase 2 Antibody (5Z8C3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:5000 - 1:30000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hexokinase 2

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq]

Alternate Names

HK2, HKII, HXK2

Gene Symbol

HK2

Additional Hexokinase 2 Products

Product Documents for Hexokinase 2 Antibody (5Z8C3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hexokinase 2 Antibody (5Z8C3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hexokinase 2 Antibody (5Z8C3)

There are currently no reviews for this product. Be the first to review Hexokinase 2 Antibody (5Z8C3) and earn rewards!

Have you used Hexokinase 2 Antibody (5Z8C3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies