Hey L Antibody (3D3) - Azide and BSA Free

Novus Biologicals | Catalog # H00026508-M12

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3D3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV

Reactivity Notes

Human. Other species not tested.

Specificity

HEYL (3D3)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for Hey L Antibody (3D3) - Azide and BSA Free

Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12] - Analysis of HEYL expression in A-431.
Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12] - Analysis of HEYL expression in U-2 OS.
Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12] - Analysis of HEYL expression in SW-13 (Cat # L005V1).
Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12]

Western Blot: Hey L Antibody (3D3) [H00026508-M12] - Analysis of HEYL expression in human pancreas.

Applications for Hey L Antibody (3D3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Hey L

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.

Alternate Names

BHLHB33, bHLHb33hHeyL, Class B basic helix-loop-helix protein 33, hairy/enhancer-of-split related with YRPW motif 3, hairy/enhancer-of-split related with YRPW motif-like, hairy/enhancer-of-split related with YRPW motif-like protein, Hairy-related transcription factor 3, HEY3, HEY-like protein, hHRT3, HRT3, HRT-3, MGC12623

Entrez Gene IDs

26508 (Human)

Gene Symbol

HEYL

OMIM

609034 (Human)

Additional Hey L Products

Product Documents for Hey L Antibody (3D3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hey L Antibody (3D3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hey L Antibody (3D3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Hey L Antibody (3D3) - Azide and BSA Free and earn rewards!

Have you used Hey L Antibody (3D3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...