HEY1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35645

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HEY1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).

Sequence:
IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HEY1 Antibody - BSA Free

HEY1 Antibody

Immunocytochemistry/ Immunofluorescence: HEY1 Antibody [NBP3-35645] -

Immunocytochemistry/ Immunofluorescence: HEY1 Antibody [NBP3-35645] - Immunofluorescence analysis of A431 cells using HEY1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
HEY1 Antibody

Western Blot: HEY1 Antibody [NBP3-35645] -

Western Blot: HEY1 Antibody [NBP3-35645] - Western blot analysis of various lysates using HEY1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for HEY1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HEY1

Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. Hey1 functions as a corepressor, providing a mechanism of cross-talk between Notch and androgen signaling pathways. It is excluded from the nucleus in most human prostate cancers.

Alternate Names

basic helix-loop-helix protein OAF1, BHLHB31, Cardiovascular helix-loop-helix factor 2, CHF-2, CHF2hHRT1, Class B basic helix-loop-helix protein 31, Hairy and enhancer of split-related protein 1, hairy/enhancer-of-split related with YRPW motif 1, hairy/enhancer-of-split related with YRPW motif protein 1, Hairy-related transcription factor 1, HERP2HES-related repressor protein 1, HESR-1, HESR1MGC1274, HES-related repressor protein 2, HRT1, HRT-1OAF1

Gene Symbol

HEY1

Additional HEY1 Products

Product Documents for HEY1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HEY1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HEY1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HEY1 Antibody - BSA Free and earn rewards!

Have you used HEY1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies