HGD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33488

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HGD Antibody - BSA Free

Western Blot: HGD Antibody [NBP2-33488]

Western Blot: HGD Antibody [NBP2-33488]

Western Blot: HGD Antibody [NBP2-33488] - Analysis using Anti-HGD antibody NBP2-33488 (A) shows similar pattern to independent antibody NBP2-49039 (B).
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human tonsil using Anti-HGD antibody NBP2-33488.
Western Blot: HGD Antibody [NBP2-33488]

Western Blot: HGD Antibody [NBP2-33488]

Western Blot: HGD Antibody [NBP2-33488] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining in human liver and tonsil tissues using anti-HGD antibody. Corresponding HGD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human gallbladder, kidney, liver and tonsil using Anti-HGD antibody NBP2-33488 (A) shows similar protein distribution across tissues to independent antibody NBP2-49039 (B).
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human kidney.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human gallbladder.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488]

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human liver using Anti-HGD antibody NBP2-33488.

Applications for HGD Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HGD

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26.

Alternate Names

AKU, EC 1.13.11.5, HGOFLJ94126, homogentisate 1,2-dioxygenase, homogentisate 1,2-dioxygenase (homogentisate oxidase), homogentisate oxidase, Homogentisate oxygenase, Homogentisic acid oxidase, Homogentisicase

Gene Symbol

HGD

UniProt

Additional HGD Products

Product Documents for HGD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HGD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HGD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HGD Antibody - BSA Free and earn rewards!

Have you used HGD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...